Animal-Free FGF-1, Human (His)

Name: Animal-Free FGF-1, Human (His)
Brand: QuantiMol
SKU: QM-0199181-01
Price: 62.26 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0199181-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. Animal-Free FGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Molecular Formula
2246 (Gene_ID) P05230-1 (F16-D155) (Accession)
Smiles
MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0199181-01	2 µgQM-0199181-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0199181-02	10 µgQM-0199181-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0199181-03	50 µgQM-0199181-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

100 µgQM-0199181-04	100 µgQM-0199181-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free FGF-1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.