Skip to product information
1 of 1

Animal-Free FGF-21, Human (His)

Animal-Free FGF-21, Human (His)

Size

SKU:QM-0196904-01

£78.82 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.Animal-Free FGF-21 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-21 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

  • Smiles

    MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0196904-01
2 µgQM-0196904-01
£78.82/ea
£0.00
£78.82/ea £0.00
10 µgQM-0196904-02
10 µgQM-0196904-02
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0196904-03
50 µgQM-0196904-03
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free FGF-21, Human (His)

Animal-Free FGF-21, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.