Animal-Free FGF-4, Human (His)

Name: Animal-Free FGF-4, Human (His)
Brand: QuantiMol
SKU: QM-0198991-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0198991-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. Animal-Free FGF-4 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-4 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Molecular Formula
2249 (Gene_ID) P08620-1 (G25-L206) (Accession)
Smiles
MGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0198991-01	2 µgQM-0198991-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0198991-02	10 µgQM-0198991-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0198991-03	50 µgQM-0198991-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free FGF-4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.