Animal-Free FGF-5, Human (His)

Name: Animal-Free FGF-5, Human (His)
Brand: QuantiMol
SKU: QM-0195376-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0195376-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Animal-Free FGF-5 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-5 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
2250 (Gene_ID) AAB06463.1 (A18-G268) (Accession)
Smiles
MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0195376-01	2 µgQM-0195376-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0195376-02	10 µgQM-0195376-02 £116.13/ea	£0.00	Quantity	£116.13/ea	£0.00

50 µgQM-0195376-03	50 µgQM-0195376-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free FGF-5, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.