Skip to product information
1 of 1

Animal-Free FGF basic/bFGF, Human (154a.a, )

Animal-Free FGF basic/bFGF, Human (154a.a, )

Size

SKU:QM-0204432-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF basic/bFGF Protein, Human (154a.a), consists of 154 amino acids, produced by E.coli with tag free.This product is for cell culture use only.

  • Molecular Formula

    2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

  • Smiles

    AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204432-01
2 µgQM-0204432-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0204432-02
10 µgQM-0204432-02
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0204432-03
50 µgQM-0204432-03
£316.08/ea
£0.00
£316.08/ea £0.00
100 µgQM-0204432-04
100 µgQM-0204432-04
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free FGF basic/bFGF, Human (154a.a, )

Animal-Free FGF basic/bFGF, Human (154a.a, ) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.