Skip to product information
1 of 1

Animal-Free G-CSF, Mouse (His)

Animal-Free G-CSF, Mouse (His)

Size

SKU:QM-0169867-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The G-CSF Protein, a monomeric cytokine in the granulocyte/macrophage colony-stimulating factor family, crucially regulates hematopoiesis by orchestrating the production, differentiation, and function of granulocytes and monocytes-macrophages. Its production emphasizes its significance in maintaining immune system balance and functionality. Animal-Free G-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    12985 (Gene_ID) P09920 (V31-A208) (Accession)

  • Smiles

    VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0169867-01
2 µgQM-0169867-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0169867-02
10 µgQM-0169867-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0169867-03
50 µgQM-0169867-03
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free G-CSF, Mouse (His)

Animal-Free G-CSF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.