Skip to product information
1 of 1

Animal-Free Galectin-14/LGALS14, Human (His)

Animal-Free Galectin-14/LGALS14, Human (His)

Size

SKU:QM-0199392-01

£73.65 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Galectin-14/LGALS14 protein has the ability to bind β-galactoside and lactose and can serve as an effective inducer of T cell apoptosis, highlighting its key role in the regulation of immune responses. Animal-Free Galectin-14/LGALS14 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-14/LGALS14 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    56891 (Gene_ID) Q8TCE9-1 (S2-D139) (Accession)

  • Smiles

    SSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199392-01
2 µgQM-0199392-01
£73.65/ea
£0.00
£73.65/ea £0.00
10 µgQM-0199392-02
10 µgQM-0199392-02
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0199392-03
50 µgQM-0199392-03
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free Galectin-14/LGALS14, Human (His)

Animal-Free Galectin-14/LGALS14, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.