Animal-Free Galectin-4/LGALS4, Human (His)

Name: Animal-Free Galectin-4/LGALS4, Human (His)
Brand: QuantiMol
SKU: QM-0193162-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0193162-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Animal-Free Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-4/LGALS4 protein, expressed by E. coli , with N-His, N-His labeled tag. This product is for cell culture use only.
Molecular Formula
3960 (Gene_ID) P56470 (A2-I323) (Accession)
Smiles
AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0193162-01	2 µgQM-0193162-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0193162-02	10 µgQM-0193162-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0193162-03	50 µgQM-0193162-03 £487.40/ea	£0.00	Quantity	£487.40/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free Galectin-4/LGALS4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.