Skip to product information
1 of 1

Animal-Free Galectin-7/LGALS7, Human (His)

Animal-Free Galectin-7/LGALS7, Human (His)

Size

SKU:QM-0125057-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Animal-Free Galectin-7/LGALS7 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-7/LGALS7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    3963 (Gene_ID) P47929 (S2-F136) (Accession)

  • Smiles

    SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0125057-01
2 µgQM-0125057-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0125057-02
10 µgQM-0125057-02
£257.76/ea
£0.00
£257.76/ea £0.00
20 µgQM-0125057-03
20 µgQM-0125057-03
£381.69/ea
£0.00
£381.69/ea £0.00
50 µgQM-0125057-04
50 µgQM-0125057-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free Galectin-7/LGALS7, Human (His)

Animal-Free Galectin-7/LGALS7, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.