Skip to product information
1 of 1

Animal-Free GDF-5, Human (His)

Animal-Free GDF-5, Human (His)

Size

SKU:QM-0196314-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. Animal-Free GDF-5 Protein, Human (His) is the recombinant human-derived animal-FreeGDF-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    8200 (Gene_ID) P43026 (A382-R501) (Accession)

  • Smiles

    MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0196314-01
2 µgQM-0196314-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0196314-02
10 µgQM-0196314-02
£187.29/ea
£0.00
£187.29/ea £0.00
50 µgQM-0196314-03
50 µgQM-0196314-03
£403.56/ea
£0.00
£403.56/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free GDF-5, Human (His)

Animal-Free GDF-5, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.