Skip to product information
1 of 1

Animal-Free GRO-alpha/CXCL1, Human (His)

Animal-Free GRO-alpha/CXCL1, Human (His)

Size

SKU:QM-0196111-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha (4-73), GRO-alpha (5-73), and GRO-alpha (6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. Animal-Free GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    2919 (Gene_ID) P09341 (A35-N107) (Accession)

  • Smiles

    ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0196111-01
2 µgQM-0196111-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0196111-02
10 µgQM-0196111-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0196111-03
50 µgQM-0196111-03
£476.46/ea
£0.00
£476.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free GRO-alpha/CXCL1, Human (His)

Animal-Free GRO-alpha/CXCL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.