Skip to product information
1 of 1

Animal-Free GRO-alpha/CXCL1, Mouse

Animal-Free GRO-alpha/CXCL1, Mouse

Size

SKU:QM-0175916-01

£107.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC (5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. Animal-Free GRO-alpha/CXCL1 Protein, Mouse is the recombinant mouse-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with tag free. This product is for cell culture use only.

  • Molecular Formula

    14825 (Gene_ID) P12850 (N29-K96) (Accession)

  • Smiles

    NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0175916-01
2 µgQM-0175916-01
£107.13/ea
£0.00
£107.13/ea £0.00
10 µgQM-0175916-02
10 µgQM-0175916-02
£293.00/ea
£0.00
£293.00/ea £0.00
50 µgQM-0175916-03
50 µgQM-0175916-03
£680.59/ea
£0.00
£680.59/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free GRO-alpha/CXCL1, Mouse

Animal-Free GRO-alpha/CXCL1, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.