Skip to product information
1 of 1

Animal-Free GRO-beta/CXCL2, Human (His)

Animal-Free GRO-beta/CXCL2, Human (His)

Size

SKU:QM-0185617-01

£98.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta (5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. Animal-Free GRO-beta/CXCL2 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-beta/CXCL2 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    2920 (Gene_ID) P19875 (A35-N107) (Accession)

  • Smiles

    APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0185617-01
2 µgQM-0185617-01
£98.13/ea
£0.00
£98.13/ea £0.00
10 µgQM-0185617-02
10 µgQM-0185617-02
£271.13/ea
£0.00
£271.13/ea £0.00
50 µgQM-0185617-03
50 µgQM-0185617-03
£580.96/ea
£0.00
£580.96/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free GRO-beta/CXCL2, Human (His)

Animal-Free GRO-beta/CXCL2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.