Animal-Free GRO-beta/CXCL2, Human (His)

Name: Animal-Free GRO-beta/CXCL2, Human (His)
Brand: QuantiMol
SKU: QM-0185617-01
Price: 98.13 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0185617-01

£98.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta (5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. Animal-Free GRO-beta/CXCL2 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-beta/CXCL2 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Molecular Formula
2920 (Gene_ID) P19875 (A35-N107) (Accession)
Smiles
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0185617-01	2 µgQM-0185617-01 £98.13/ea	£0.00	Quantity	£98.13/ea	£0.00

10 µgQM-0185617-02	10 µgQM-0185617-02 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

50 µgQM-0185617-03	50 µgQM-0185617-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free GRO-beta/CXCL2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.