Animal-Free HMGB1/HMG-1, Mouse (His)

Name: Animal-Free HMGB1/HMG-1, Mouse (His)
Brand: QuantiMol
SKU: QM-0193460-01
Price: 101.5 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0193460-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. Animal-Free HMGB1/HMG-1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeHMGB1/HMG-1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
15289 (Gene_ID) P63158 (M1-E215) (Accession)
Smiles
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0193460-01	2 µgQM-0193460-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

10 µgQM-0193460-02	10 µgQM-0193460-02 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

50 µgQM-0193460-03	50 µgQM-0193460-03 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free HMGB1/HMG-1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.