Animal-Free I-TAC/CXCL11, Pig (His)

I-TAC/CXCL11 Protein exhibits broad expression, notably in the lung (RPKM 3.0), mixtures (RPKM 2.0), and seven other tissues. This widespread distribution suggests its integral role in diverse physiological processes across different organ systems, underscoring the protein's significance in various biological contexts. Animal-Free I-TAC/CXCL11 Protein, Pig (His) is the recombinant pig-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

100169744 (Gene_ID) B3GDY9 (F22-V100) (Accession)

FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV

Room temperature in continental US; may vary elsewhere.