Skip to product information
1 of 1

Animal-Free IFN alpha 1/IFNA1, Mouse (His)

Animal-Free IFN alpha 1/IFNA1, Mouse (His)

Size

SKU:QM-0181821-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. Animal-Free IFN alpha 1/IFNA1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN alpha 1a protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    15962 (Gene_ID) P01572 (C24-K189) (Accession)

  • Smiles

    CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0181821-01
2 µgQM-0181821-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0181821-02
10 µgQM-0181821-02
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0181821-03
50 µgQM-0181821-03
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IFN alpha 1/IFNA1, Mouse (His)

Animal-Free IFN alpha 1/IFNA1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.