1 1

Animal-Free IFN-lambda 1/IL-29, Human (His)

Animal-Free IFN-lambda 1/IL-29, Human (His)

Size

QM-0200853-01

£81.92 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IFN-lambda 1/IL-29 protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, especially in epithelial tissues. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 1/IL-29 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    282618 (Gene_ID) Q8IU54 (P23-T200) (Accession)

  • Smiles

    MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0200853-01
2 µgQM-0200853-01
£81.92/ea		 £0.00
£81.92/ea £0.00
10 µgQM-0200853-02
10 µgQM-0200853-02
£238.32/ea		 £0.00
£238.32/ea £0.00
50 µgQM-0200853-03
50 µgQM-0200853-03
£614.98/ea		 £0.00
£614.98/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Animal-Free IFN-lambda 1/IL-29, Human (His)

Animal-Free IFN-lambda 1/IL-29, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.