1 1

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Size

QM-0186526-01

£97.00 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    338374 (Gene_ID) Q8CGK6 (D20-V193) (Accession)

  • Smiles

    MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0186526-01
2 µgQM-0186526-01
£97.00/ea		 £0.00
£97.00/ea £0.00
10 µgQM-0186526-02
10 µgQM-0186526-02
£271.13/ea		 £0.00
£271.13/ea £0.00
50 µgQM-0186526-03
50 µgQM-0186526-03
£669.65/ea		 £0.00
£669.65/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Animal-Free IFN-lambda 3/IL-28B, Mouse (His)

Animal-Free IFN-lambda 3/IL-28B, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.