Animal-Free IGF-I/IGF-1, Mouse (His)

Name: Animal-Free IGF-I/IGF-1, Mouse (His)
Brand: QuantiMol
SKU: QM-0194718-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0194718-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. Animal-Free IGF-I/IGF-1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIGF-I/IGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Molecular Formula
16000 (Gene_ID) P05017-1 (G49-A118) (Accession)
Smiles
MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0194718-01	2 µgQM-0194718-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0194718-02	10 µgQM-0194718-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0194718-03	50 µgQM-0194718-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IGF-I/IGF-1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.