Skip to product information
1 of 1

Animal-Free IGF-I, Pig (His)

Animal-Free IGF-I, Pig (His)

Size

SKU:QM-0085765

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    397491 (Gene_ID) P16545 (G49-A118) (Accession)

  • Smiles

    MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0085765
1 EachQM-0085765
£0.00/ea
£0.00
£0.00/ea £0.00

Animal-Free IGF-I, Pig (His)

Animal-Free IGF-I, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.