Skip to product information
1 of 1

Animal-Free IGF2, Human (His)

Animal-Free IGF2, Human (His)

Size

SKU:QM-0181706-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. Animal-Free IGF2 Protein, Human (His) is the recombinant human-derived animal-FreeIGF2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    3481 (Gene_ID) P01344-1 (A25-E91) (Accession)

  • Smiles

    AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0181706-01
2 µgQM-0181706-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0181706-02
10 µgQM-0181706-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0181706-03
50 µgQM-0181706-03
£316.08/ea
£0.00
£316.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IGF2, Human (His)

Animal-Free IGF2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.