Skip to product information
1 of 1

Animal-Free IL-13, Human (His)

Animal-Free IL-13, Human (His)

Size

SKU:QM-0192760-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    3596 (Gene_ID) P35225 (G35-N146) (Accession)

  • Smiles

    MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0192760-01
2 µgQM-0192760-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0192760-02
10 µgQM-0192760-02
£267.49/ea
£0.00
£267.49/ea £0.00
50 µgQM-0192760-03
50 µgQM-0192760-03
£658.72/ea
£0.00
£658.72/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-13, Human (His)

Animal-Free IL-13, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.