Animal-Free IL-13, Mouse (His)

Name: Animal-Free IL-13, Mouse (His)
Brand: QuantiMol
SKU: QM-0197217-01
Price: 81.92 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0197217-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. Animal-Free IL-13 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
16163 (Gene_ID) P20109 (P22-F131) (Accession)
Smiles
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0197217-01	2 µgQM-0197217-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0197217-02	10 µgQM-0197217-02 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0197217-03	50 µgQM-0197217-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IL-13, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.