Animal-Free IL-15, Pig (His)

Name: Animal-Free IL-15, Pig (His)
Brand: QuantiMol
SKU: QM-0089745-01
Price: 76.75 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0089745-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IL-15 protein is a key cytokine that promotes inflammatory and protective immune responses against invaders by regulating immune cells in the innate and adaptive systems. It stimulates natural killer cells, T cells and B cells, and promotes the secretion of various cytokines. Animal-Free IL-15 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Molecular Formula
397683 (Gene_ID) Q95253 (T49-S162) (Accession)
Smiles
TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0089745-01	2 µgQM-0089745-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0089745-02	10 µgQM-0089745-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0089745-03	50 µgQM-0089745-03 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IL-15, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.