1 1

Animal-Free IL-16, Human (His)

Animal-Free IL-16, Human (His)

Size

QM-0102986

Price on request

Request quote or documents

View full details

Product Details

  • Description

    Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

  • Smiles

    MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0102986
1 EachQM-0102986
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

Animal-Free IL-16, Human (His)

Animal-Free IL-16, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.