Skip to product information
1 of 1

Animal-Free IL-17A, Human (His)

Animal-Free IL-17A, Human (His)

Size

SKU:QM-0187599-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. Animal-Free IL-17A Protein, Human (His) is the recombinant human-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    3605 (Gene_ID) Q16552 (I20-A155) (Accession)

  • Smiles

    MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0187599-01
2 µgQM-0187599-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0187599-02
10 µgQM-0187599-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0187599-03
50 µgQM-0187599-03
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-17A, Human (His)

Animal-Free IL-17A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.