Skip to product information
1 of 1

Animal-Free IL-17A, Mouse (His)

Animal-Free IL-17A, Mouse (His)

Size

SKU:QM-0182327-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. Animal-Free IL-17A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    16171 (Gene_ID) Q62386 (A26-A158) (Accession)

  • Smiles

    MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0182327-01
2 µgQM-0182327-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0182327-02
10 µgQM-0182327-02
£271.13/ea
£0.00
£271.13/ea £0.00
50 µgQM-0182327-03
50 µgQM-0182327-03
£669.65/ea
£0.00
£669.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-17A, Mouse (His)

Animal-Free IL-17A, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.