Skip to product information
1 of 1

Animal-Free IL-17B, Mouse (His)

Animal-Free IL-17B, Mouse (His)

Size

SKU:QM-0195054-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    56069 (Gene_ID) Q9QXT6 (H21-F180) (Accession)

  • Smiles

    MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0195054-01
2 µgQM-0195054-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0195054-02
10 µgQM-0195054-02
£235.90/ea
£0.00
£235.90/ea £0.00
50 µgQM-0195054-03
50 µgQM-0195054-03
£570.02/ea
£0.00
£570.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-17B, Mouse (His)

Animal-Free IL-17B, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.