Skip to product information
1 of 1

Animal-Free IL-17D, Human (His)

Animal-Free IL-17D, Human (His)

Size

SKU:QM-0194824-01

£103.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. Animal-Free IL-17D Protein, Human (His) is the recombinant human-derived animal-FreeIL-17D protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    53342 (Gene_ID) Q8TAD2 (A18-P202) (Accession)

  • Smiles

    APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0194824-01
2 µgQM-0194824-01
£103.75/ea
£0.00
£103.75/ea £0.00
10 µgQM-0194824-02
10 µgQM-0194824-02
£288.14/ea
£0.00
£288.14/ea £0.00
50 µgQM-0194824-03
50 µgQM-0194824-03
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-17D, Human (His)

Animal-Free IL-17D, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.