Skip to product information
1 of 1

Animal-Free IL-23 alpha, Human (His)

Animal-Free IL-23 alpha, Human (His)

Size

SKU:QM-0204069-01

£116.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. Animal-Free IL-23 alpha Protein, Human (His) is the recombinant human-derived animal-FreeIL-23 p19 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    51561 (Gene_ID) Q9NPF7 (R20-P189) (Accession)

  • Smiles

    RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204069-01
2 µgQM-0204069-01
£116.13/ea
£0.00
£116.13/ea £0.00
5 µgQM-0204069-02
5 µgQM-0204069-02
£237.11/ea
£0.00
£237.11/ea £0.00
10 µgQM-0204069-03
10 µgQM-0204069-03
£348.89/ea
£0.00
£348.89/ea £0.00
50 µgQM-0204069-04
50 µgQM-0204069-04
£887.13/ea
£0.00
£887.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-23 alpha, Human (His)

Animal-Free IL-23 alpha, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.