Skip to product information
1 of 1

Animal-Free IL-27 beta/EBI3, Human (His)

Animal-Free IL-27 beta/EBI3, Human (His)

Size

SKU:QM-0200745-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IL-27 beta/EBI3 protein binds to IL27 to form IL-27 interleukin, which is critical in innate immunity. IL-27 has both pro- and anti-inflammatory properties, regulating T helper cell development, inhibiting T cell proliferation, stimulating cytotoxic T cell activity, inducing B cell isotype switching, and affecting innate immune cells. Animal-Free IL-27 beta/EBI3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-27 beta/EBI3 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    10148 (Gene_ID) Q14213 (R21-K229) (Accession)

  • Smiles

    MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0200745-01
2 µgQM-0200745-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0200745-02
10 µgQM-0200745-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0200745-03
50 µgQM-0200745-03
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-27 beta/EBI3, Human (His)

Animal-Free IL-27 beta/EBI3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.