Animal-Free IL-27 beta EBI3, Mouse (His)

Name: Animal-Free IL-27 beta EBI3, Mouse (His)
Brand: QuantiMol
SKU: QM-0193946-01
Price: 100.38 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0193946-01

£100.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. Animal-Free IL-27 beta EBI3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-27 EBI3 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Molecular Formula
50498 (Gene_ID) O35228 (A23-P228) (Accession)
Smiles
MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0193946-01	2 µgQM-0193946-01 £100.38/ea	£0.00	Quantity	£100.38/ea	£0.00

10 µgQM-0193946-02	10 µgQM-0193946-02 £277.21/ea	£0.00	Quantity	£277.21/ea	£0.00

50 µgQM-0193946-03	50 µgQM-0193946-03 £680.59/ea	£0.00	Quantity	£680.59/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IL-27 beta EBI3, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.