Skip to product information
1 of 1

Animal-Free IL-3, Mouse (His)

Animal-Free IL-3, Mouse (His)

Size

SKU:QM-0194849-01

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts.It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes.In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation.Animal-Free IL-3 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-3 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    16187 (Gene_ID) P01586 (D33-C166) (Accession)

  • Smiles

    MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0194849-01
2 µgQM-0194849-01
£117.25/ea
£0.00
£117.25/ea £0.00
10 µgQM-0194849-02
10 µgQM-0194849-02
£277.21/ea
£0.00
£277.21/ea £0.00
50 µgQM-0194849-03
50 µgQM-0194849-03
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-3, Mouse (His)

Animal-Free IL-3, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.