Skip to product information
1 of 1

Animal-Free IL-4, Pig (His)

Animal-Free IL-4, Pig (His)

Size

SKU:QM-0199578-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-4 protein is actively involved in the activation process of B cells and various cell types, acting as a costimulator of DNA synthesis. It induces expression of MHC class II molecules by resting B cells and enhances IgE and IgG1 secretion and cell surface expression. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    397225 (Gene_ID) Q04745 (H25-C133) (Accession)

  • Smiles

    MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199578-01
2 µgQM-0199578-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0199578-02
10 µgQM-0199578-02
£288.14/ea
£0.00
£288.14/ea £0.00
50 µgQM-0199578-03
50 µgQM-0199578-03
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free IL-4, Pig (His)

Animal-Free IL-4, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.