Animal-Free IL-6, Human (His)

Name: Animal-Free IL-6, Human (His)
Brand: QuantiMol
SKU: QM-0201433-01
Price: 81.92 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0201433-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. Animal-Free IL-6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Molecular Formula
3569 (Gene_ID) P05231 (P29-M212) (Accession)
Smiles
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201433-01	2 µgQM-0201433-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0201433-02	10 µgQM-0201433-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0201433-03	50 µgQM-0201433-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IL-6, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.