Animal-Free IL-8/CXCL8, Pig (His)
Animal-Free IL-8/CXCL8, Pig (His)
SKU:QM-0121013
Request quote or documents

Product Details
-
Description
IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
-
Molecular Formula
396880 (Gene_ID) CAA43461 (A26-Q103) (Accession)
-
Smiles
MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Animal-Free IL-8/CXCL8, Pig (His)
Animal-Free IL-8/CXCL8, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.