Skip to product information
1 of 1

Animal-Free IL-8/CXCL8, Pig (His)

Animal-Free IL-8/CXCL8, Pig (His)

Size

SKU:QM-0121013

Price on request
Quantity

Request quote or documents

View full details
  • Description

    IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    396880 (Gene_ID) CAA43461 (A26-Q103) (Accession)

  • Smiles

    MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0121013
1 EachQM-0121013
£0.00/ea
£0.00
£0.00/ea £0.00

Animal-Free IL-8/CXCL8, Pig (His)

Animal-Free IL-8/CXCL8, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.