Animal-Free IP-10/CXCL10, Human (His)

Name: Animal-Free IP-10/CXCL10, Human (His)
Brand: QuantiMol
SKU: QM-0183545-01
Price: 63.29 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 20 µg 50 µg

SKU:QM-0183545-01

£63.29 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IP-10/CRG-2/CXCL10 protein is a pro-inflammatory cytokine involved in a variety of biological processes, including chemotaxis, immune cell activation, growth regulation, apoptosis, and vasostatic regulation. During viral infection, IP-10 crucially stimulates immune cell activation and migration to the site of infection. Animal-Free IP-10/CXCL10 Protein, Human (His) is the recombinant human-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Molecular Formula
3627 (Gene_ID) P02778 (V22-P98) (Accession)
Smiles
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0183545-01	2 µgQM-0183545-01 £63.29/ea	£0.00	Quantity	£63.29/ea	£0.00

5 µgQM-0183545-02	5 µgQM-0183545-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

10 µgQM-0183545-03	10 µgQM-0183545-03 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

20 µgQM-0183545-04	20 µgQM-0183545-04 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

50 µgQM-0183545-05	50 µgQM-0183545-05 £470.39/ea	£0.00	Quantity	£470.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free IP-10/CXCL10, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.