Skip to product information
1 of 1

Animal-Free M-CSF, Human (His)

Animal-Free M-CSF, Human (His)

Size

SKU:QM-0197245-01

£79.85 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    1435 (Gene_ID) NP_757350.2 (E33-S190) (Accession)

  • Smiles

    MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0197245-01
2 µgQM-0197245-01
£79.85/ea
£0.00
£79.85/ea £0.00
10 µgQM-0197245-02
10 µgQM-0197245-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0197245-03
50 µgQM-0197245-03
£476.46/ea
£0.00
£476.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free M-CSF, Human (His)

Animal-Free M-CSF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.