Skip to product information
1 of 1

Animal-Free M-CSF, Mouse (His)

Animal-Free M-CSF, Mouse (His)

Size

SKU:QM-0199692-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    12977 (Gene_ID) P07141-1 (K33-P187) (Accession)

  • Smiles

    MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199692-01
2 µgQM-0199692-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0199692-02
10 µgQM-0199692-02
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0199692-03
50 µgQM-0199692-03
£604.04/ea
£0.00
£604.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free M-CSF, Mouse (His)

Animal-Free M-CSF, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.