Skip to product information
1 of 1

Animal-Free MIG/CXCL9, Human (His)

Animal-Free MIG/CXCL9, Human (His)

Size

SKU:QM-0188293-01

£115.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    MIG, also known as CXCL9 protein, occurs as a cytokine that affects the growth, movement, or activation state of cells involved in immune and inflammatory responses. Specifically, it acts as a potent chemoattractant for activated T cells, coordinating their migration. Animal-Free MIG/CXCL9 Protein, Human (His) is the recombinant human-derived animal-FreeMIG/CXCL9 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    4283 (Gene_ID) Q07325 (T23-T125) (Accession)

  • Smiles

    TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0188293-01
2 µgQM-0188293-01
£115.00/ea
£0.00
£115.00/ea £0.00
10 µgQM-0188293-02
10 µgQM-0188293-02
£316.08/ea
£0.00
£316.08/ea £0.00
50 µgQM-0188293-03
50 µgQM-0188293-03
£591.89/ea
£0.00
£591.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free MIG/CXCL9, Human (His)

Animal-Free MIG/CXCL9, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.