Animal-Free MIP-2/CXCL2, Mouse (His)

Name: Animal-Free MIP-2/CXCL2, Mouse (His)
Brand: QuantiMol
SKU: QM-0196854-01
Price: 67.44 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0196854-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Molecular Formula
20310 (Gene_ID) P10889 (A28-N100) (Accession)
Smiles
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0196854-01	2 µgQM-0196854-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0196854-02	10 µgQM-0196854-02 £193.37/ea	£0.00	Quantity	£193.37/ea	£0.00

50 µgQM-0196854-03	50 µgQM-0196854-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free MIP-2/CXCL2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.