Skip to product information
1 of 1

Animal-Free NAP-2/CXCL7, Human (His)

Animal-Free NAP-2/CXCL7, Human (His)

Size

SKU:QM-0199611-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    NAP-2/CXCL7 protein (LA-PF4) triggers DNA synthesis, mitosis, glycolysis, cAMP accumulation, and hyaluronic acid synthesis. It contributes to the formation of plasminogen activator in human synovial cells and acts as a CXCR1/CXCR2 ligand together with variants such as NAP-2 (73) . Animal-Free NAP-2/CXCL7 Protein, Human (His) is the recombinant human-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    5473 (Gene_ID) P02775 (A59-D128) (Accession)

  • Smiles

    AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199611-01
2 µgQM-0199611-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0199611-02
10 µgQM-0199611-02
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0199611-03
50 µgQM-0199611-03
£492.26/ea
£0.00
£492.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free NAP-2/CXCL7, Human (His)

Animal-Free NAP-2/CXCL7, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.