Skip to product information
1 of 1

Animal-Free Neurturin, Human (His)

Animal-Free Neurturin, Human (His)

Size

SKU:QM-0201932-01

£75.72 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS) . It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Animal-Free Neurturin Protein, Human (His) is the recombinant human-derived animal-FreeNeurturin protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    4902 (Gene_ID) Q99748 (A96-V197) (Accession)

  • Smiles

    MARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0201932-01
2 µgQM-0201932-01
£75.72/ea
£0.00
£75.72/ea £0.00
10 µgQM-0201932-02
10 µgQM-0201932-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0201932-03
50 µgQM-0201932-03
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free Neurturin, Human (His)

Animal-Free Neurturin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.