Name: Animal-Free Neurturin, Mouse (His)
Brand: QuantiMol
SKU: QM-0199453-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Molecular Formula
18188 (Gene_ID) P97463.1 (P96-V195) (Accession)
Smiles
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0199453-01	2 µgQM-0199453-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0199453-02	10 µgQM-0199453-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0199453-03	50 µgQM-0199453-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0199453-04	100 µgQM-0199453-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

200 µgQM-0199453-05	200 µgQM-0199453-05 £1,046.30/ea	£0.00	Quantity	£1,046.30/ea	£0.00

500 µgQM-0199453-06	500 µgQM-0199453-06 £1,932.04/ea	£0.00	Quantity	£1,932.04/ea	£0.00

1 mgQM-0199453-07	1 mgQM-0199453-07 £3,038.90/ea	£0.00	Quantity	£3,038.90/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free Neurturin, Mouse (His)

Animal-Free Neurturin, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.