Skip to product information
1 of 1

Animal-Free Nodal, Human (His)

Animal-Free Nodal, Human (His)

Size

SKU:QM-0077848-01

£110.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. Animal-Free Nodal Protein, Human (His) is the recombinant human-derived animal-FreeNodal protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Molecular Formula

    4838 (Gene_ID) Q96S42 (H238-L347) (Accession)

  • Smiles

    MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0077848-01
2 µgQM-0077848-01
£110.50/ea
£0.00
£110.50/ea £0.00
10 µgQM-0077848-02
10 µgQM-0077848-02
£306.37/ea
£0.00
£306.37/ea £0.00
50 µgQM-0077848-03
50 µgQM-0077848-03
£766.85/ea
£0.00
£766.85/ea £0.00
100 µgQM-0077848-04
100 µgQM-0077848-04
£1,267.43/ea
£0.00
£1,267.43/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free Nodal, Human (His)

Animal-Free Nodal, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.