Skip to product information
1 of 1

Animal-Free Noggin, Human (His)

Animal-Free Noggin, Human (His)

Size

SKU:QM-0188854-01

£94.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Noggin is an antagonist of bone morphogenetic proteins (BMPs) and a member of the TGF-β superfamily, existing as a homodimer. Noggin binds to BMP-2/-4/-7 and inhibits their binding to BMPR-I/II receptors, thereby synergistically inducing bone differentiation in HMSCs, maintaining pluripotency in hESCs, inhibiting angiogenesis in HUVECs, and promoting myelination in oligodendrocytes, exerting neural activity[1][2][3][4]. Animal-Free Noggin Protein, Human (His) is an animal-free, recombinant human Noggin protein expressed in E. coli with a C-His tag. This product is recommended for use in cell culture.

  • Molecular Formula

    9241 (Gene_ID) Q13253 (Q28-C232) (Accession)

  • Smiles

    MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0188854-01
2 µgQM-0188854-01
£94.75/ea
£0.00
£94.75/ea £0.00
10 µgQM-0188854-02
10 µgQM-0188854-02
£277.21/ea
£0.00
£277.21/ea £0.00
50 µgQM-0188854-03
50 µgQM-0188854-03
£736.48/ea
£0.00
£736.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free Noggin, Human (His)

Animal-Free Noggin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.