Skip to product information
1 of 1

Animal-Free TGF beta 1/TGFB1, Mouse/Rat (His)

Animal-Free TGF beta 1/TGFB1, Mouse/Rat (His)

Size

SKU:QM-0176594-01

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    In its proprotein form, the TGF beta-1/TGFB1 protein serves as a precursor to latency-associated peptide (LAP) and active transforming growth factor beta-1 (TGF-beta-1) chains.Critical to maintaining the latent state of TGF-β-1 within the extracellular matrix, preprotein interacts with “environmental molecules” such as LTBP1, LRRC32/GARP, and LRRC33/NRROS to regulate TGF-β-1 activation.Animal-Free TGF beta 1/TGFB1 Protein, Mouse/Rat (His) is the recombinant mouse-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

  • Molecular Formula

    21803/59086 (Gene_ID) P04202/P17246 (A279-S390) (Accession)

  • Smiles

    MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0176594-01
2 µgQM-0176594-01
£117.25/ea
£0.00
£117.25/ea £0.00
10 µgQM-0176594-02
10 µgQM-0176594-02
£305.15/ea
£0.00
£305.15/ea £0.00
50 µgQM-0176594-03
50 µgQM-0176594-03
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Animal-Free TGF beta 1/TGFB1, Mouse/Rat (His)

Animal-Free TGF beta 1/TGFB1, Mouse/Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.