Animal-Free TNF-alpha/TNFSF2, Mouse (His)

Name: Animal-Free TNF-alpha/TNFSF2, Mouse (His)
Brand: QuantiMol
SKU: QM-0195538-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0195538-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen.It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance.Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E.coli , with C-His, C-His labeled tag.This product is for cell culture use only.
Molecular Formula
21926 (Gene_ID) P06804 (L80-L235) (Accession)
Smiles
MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0195538-01	2 µgQM-0195538-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0195538-02	10 µgQM-0195538-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0195538-03	50 µgQM-0195538-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Animal-Free TNF-alpha/TNFSF2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.