Skip to product information
1 of 1

Anionic trypsin, Dog (His-SUMO)

Anionic trypsin, Dog (His-SUMO)

Size

SKU:QM-0116020

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin Protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Molecular Formula

    100686744 (Gene_ID) P06872 (I24-S247) (Accession)

  • Smiles

    IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0116020
1 EachQM-0116020
£0.00/ea
£0.00
£0.00/ea £0.00

Anionic trypsin, Dog (His-SUMO)

Anionic trypsin, Dog (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.