Skip to product information
1 of 1

APBA3, Human (His)

APBA3, Human (His)

Size

SKU:QM-0100363

Price on request
Quantity

Request quote or documents

View full details
  • Description

    APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes[1].

  • Molecular Formula

    9546 (Gene_ID) O96018 (M1-L138) (Accession)

  • Smiles

    MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLHHHHHH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0100363
1 EachQM-0100363
£0.00/ea
£0.00
£0.00/ea £0.00

APBA3, Human (His)

APBA3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.